Democratic Underground Latest Greatest Lobby Journals Search Options Help Login
Google

What's the LONGEST word you know?

Printer-friendly format Printer-friendly format
Printer-friendly format Email this thread to a friend
Printer-friendly format Bookmark this thread
This topic is archived.
Home » Discuss » The DU Lounge Donate to DU
 
newsguyatl Donating Member (1000+ posts) Send PM | Profile | Ignore Wed Aug-13-03 06:57 PM
Original message
What's the LONGEST word you know?
here's mine: floccinaucinihilipilification (i challenge you to beat me...hehe)

definition: the act of declaring something as worthless

used in a sentence: "i enjoy DU because of its members' incessant floccinaucinihilipilification of george shrubya bush."

Printer Friendly | Permalink |  | Top
OzzieNelson Donating Member (21 posts) Send PM | Profile | Ignore Wed Aug-13-03 06:59 PM
Response to Original message
1. gitcherassouttabedingittaschool!!!
My dad used to say it alot.
Printer Friendly | Permalink |  | Top
 
short bus president Donating Member (1000+ posts) Send PM | Profile | Ignore Wed Aug-13-03 06:59 PM
Response to Original message
2. "tarnation"
pronounced by an elderly and grizzled prospector.

Printer Friendly | Permalink |  | Top
 
roughsatori Donating Member (1000+ posts) Send PM | Profile | Ignore Wed Aug-13-03 07:01 PM
Response to Original message
3. Supercalifragilisticexpialidocious NT
Printer Friendly | Permalink |  | Top
 
King_Crimson Donating Member (1000+ posts) Send PM | Profile | Ignore Thu Aug-14-03 08:58 AM
Response to Reply #3
33. "Even though the sound of it is something...
quite atrocious......"
Printer Friendly | Permalink |  | Top
 
sociopath Donating Member (90 posts) Send PM | Profile | Ignore Wed Aug-13-03 07:02 PM
Response to Original message
4. hmm...
Antidissistablishmentairianism.

Disliking those who like establishments?

:shrug:
Printer Friendly | Permalink |  | Top
 
Runesong Donating Member (219 posts) Send PM | Profile | Ignore Wed Aug-13-03 07:11 PM
Response to Reply #4
7. Err.. actualy wouldn't that mean
Someone who doesn't like people who don't like the establishment?

I have no idea. This is a totally confusing non-non-non-non-Bill and Ted moment.
Printer Friendly | Permalink |  | Top
 
goobergunch Donating Member (1000+ posts) Send PM | Profile | Ignore Wed Aug-13-03 07:12 PM
Response to Reply #4
9. Let's break this down
Anti-
diss-
istablishment
-airianism.

I think that's a double negative...
Printer Friendly | Permalink |  | Top
 
Xithras Donating Member (1000+ posts) Send PM | Profile | Ignore Wed Aug-13-03 07:16 PM
Response to Reply #4
11. Not establishments, churches
Disestablishment is the seperation of church and state. Antidisestablishment is the joining of church and state Antidisestablishmentarianism is the concept of supporting and encouraging the merging of church and state. George Bush is an antidisestablishmentarianist...a person who wants to create a theocratic government.

In otherwords Antidisestablishmentarianism = Bad Mojo
Printer Friendly | Permalink |  | Top
 
Runesong Donating Member (219 posts) Send PM | Profile | Ignore Wed Aug-13-03 07:35 PM
Response to Reply #11
16. So Antiantidisestablishmentarianism
would mean you are for the seperation of church and state?

Printer Friendly | Permalink |  | Top
 
GumboYaYa Donating Member (1000+ posts) Send PM | Profile | Ignore Wed Aug-13-03 07:02 PM
Response to Original message
5. Too funny, I've been in all afternoon
Edited on Wed Aug-13-03 07:03 PM by GumboYaYa
debate over Lieberman and the First Amendment, so my word is "antidisestablismentarianism".
Printer Friendly | Permalink |  | Top
 
Xithras Donating Member (1000+ posts) Send PM | Profile | Ignore Wed Aug-13-03 07:08 PM
Response to Original message
6. Longest real word in the English language
acetylseryltyrosylserylisoleucylthreonylserylprolylserylglutaminyl-
phenylalanylvalylphenylalanylleucylserylserylvalyltryptophylalanyl-
aspartylprolylisoleucylglutamylleucylleucylasparaginylvalylcysteinyl-
threonylserylserylleucylglycylasparaginylglutaminylphenylalanyl-
glutaminylthreonylglutaminylglutaminylalanylarginylthreonylthreonyl-
glutaminylvalylglutaminylglutaminylphenylalanylserylglutaminylvalyl-
tryptophyllysylprolylphenylalanylprolylglutaminylserylthreonylvalyl-
arginylphenylalanylprolylglycylaspartylvalyltyrosyllysylvalyltyrosyl-
arginyltyrosylasparaginylalanylvalylleucylaspartylprolylleucylisoleucyl-
threonylalanylleucylleucylglycylthreonylphenylalanylaspartylthreonyl-
arginylasparaginylarginylisoleucylisoleucylglutamylvalylglutamyl-
asparaginylglutaminylglutaminylserylprolylthreonylthreonylalanylglutamyl-
threonylleucylaspartylalanylthreonylarginylarginylvalylaspartylaspartyl-
alanylthreonylvalylalanylisoleucylarginylserylalanylasparaginylisoleucyl-
asparaginylleucylvalylasparaginylglutamylleucylvalylarginylglycyl-
threonylglycylleucyltyrosylasparaginylglutaminylasparaginylthreonyl-
phenylalanylglutamylserylmethionylserylglycylleucylvalyltryptophyl-
threonylserylalanylprolylalanylserine

It's 1,185 letters and is the RNA description (chemistry) for the Tobacco Mosaic Virus
Printer Friendly | Permalink |  | Top
 
Gman Donating Member (1000+ posts) Send PM | Profile | Ignore Wed Aug-13-03 07:11 PM
Response to Reply #6
8. Yeah, but can you draw
acetylseryltyrosylserylisoleucylthreonylserylprolylserylglutaminyl-
phenylalanylvalylphenylalanylleucylserylserylvalyltryptophylalanyl-
aspartylprolylisoleucylglutamylleucylleucylasparaginylvalylcysteinyl-
threonylserylserylleucylglycylasparaginylglutaminylphenylalanyl-
glutaminylthreonylglutaminylglutaminylalanylarginylthreonylthreonyl-
glutaminylvalylglutaminylglutaminylphenylalanylserylglutaminylvalyl-
tryptophyllysylprolylphenylalanylprolylglutaminylserylthreonylvalyl-
arginylphenylalanylprolylglycylaspartylvalyltyrosyllysylvalyltyrosyl-
arginyltyrosylasparaginylalanylvalylleucylaspartylprolylleucylisoleucyl-
threonylalanylleucylleucylglycylthreonylphenylalanylaspartylthreonyl-
arginylasparaginylarginylisoleucylisoleucylglutamylvalylglutamyl-
asparaginylglutaminylglutaminylserylprolylthreonylthreonylalanylglutamyl-
threonylleucylaspartylalanylthreonylarginylarginylvalylaspartylaspartyl-
alanylthreonylvalylalanylisoleucylarginylserylalanylasparaginylisoleucyl-
asparaginylleucylvalylasparaginylglutamylleucylvalylarginylglycyl-
threonylglycylleucyltyrosylasparaginylglutaminylasparaginylthreonyl-
phenylalanylglutamylserylmethionylserylglycylleucylvalyltryptophyl-
threonylserylalanylprolylalanylserine?
Printer Friendly | Permalink |  | Top
 
goobergunch Donating Member (1000+ posts) Send PM | Profile | Ignore Wed Aug-13-03 07:38 PM
Response to Reply #8
17. Yes
Printer Friendly | Permalink |  | Top
 
jafap Donating Member (654 posts) Send PM | Profile | Ignore Wed Aug-13-03 07:21 PM
Response to Reply #6
12. hard to believe
a) that it's a real word and
b) that there are not bigger proteins

I think the longest word is that Welsh village, but it does not seem legit either because of all the ggg and lll's in it.
I cannot find the email of the long German word except that it starts with Donau... and it means "captain of the Danube shipping line"
Printer Friendly | Permalink |  | Top
 
Xithras Donating Member (1000+ posts) Send PM | Profile | Ignore Wed Aug-13-03 07:31 PM
Response to Reply #12
14. Well
Google "Tobacco Mosaic Virus" and you'll probably find a few websites discussing the length of the RNA description. That IS the longest published word in the English language.

If there are bigger proteins, they have multi-word names.
Printer Friendly | Permalink |  | Top
 
THUNDER HANDS Donating Member (1000+ posts) Send PM | Profile | Ignore Wed Aug-13-03 07:35 PM
Response to Reply #12
15. it's not that one...but I hill in New Zeland called....
drum roll please....


Taumatawhakatang­ihangakoauauot­amateaturipukaka­pikimaunga­horonukuokaiwhenuak­itanatahu
Printer Friendly | Permalink |  | Top
 
Kellanved Donating Member (1000+ posts) Send PM | Profile | Ignore Thu Aug-14-03 07:54 AM
Response to Reply #12
28. Donaudampfschifffahrtsgesellschaftskapitän
or Donaudampfschifffahrtsgesellschaftskapitänswitwe for his widow.
We have "zusammengesetzte Nomen", you can plug two substantives together, creating a new one.
Printer Friendly | Permalink |  | Top
 
Karenina Donating Member (1000+ posts) Send PM | Profile | Ignore Thu Aug-14-03 09:43 AM
Response to Reply #28
36. Danube steamship journey company captain...
Love those German compound nouns. My usual tactic is break them down in to their components. It only works a SMALL percentage of the time. There are even "rules" for how you're allowed to do it. I'm always trying to make up words but people just look at me like I'm from another planet... :shrug:
Printer Friendly | Permalink |  | Top
 
Dimsdale Donating Member (466 posts) Send PM | Profile | Ignore Wed Aug-13-03 07:39 PM
Response to Reply #6
18. I hate to nitpick..
but, isn't DNA/RNA made up of nucleic acids? What you've here is a protein, composed of amino acids.
Printer Friendly | Permalink |  | Top
 
Iverson Donating Member (1000+ posts) Send PM | Profile | Ignore Thu Aug-14-03 08:13 AM
Response to Reply #6
29. pneumonoultramicroscopicsilicovolcanoconiosis
pneumonoultramicroscopicsilicovolcanoconiosis
Printer Friendly | Permalink |  | Top
 
rucky Donating Member (1000+ posts) Send PM | Profile | Ignore Wed Aug-13-03 07:15 PM
Response to Original message
10. Waaaaasssssuuuuuuuuup!
Printer Friendly | Permalink |  | Top
 
Tom Kitten Donating Member (1000+ posts) Send PM | Profile | Ignore Wed Aug-13-03 07:23 PM
Response to Original message
13. And then there's...

Methionylglutaminylarginyltyrosylglutamylserylleucylphenyl-
alanylalanylglutaminylleucyllysylglutamylarginyllysyglutamyl-
gycylalanylphenylalanylvalylprolylphenylalanylvalylthreonyl-
leucylglycylaspartylprolylglycyllisoleucylglutamylglutaminyl-
serylleucyllysylisoleucylaspartylthreonylleucylisoleucyl-
glutamylalanylglycylalanylaspartylalanylleucylglutamylleucyl-
glycylisoleucylprolylphenylalanylserylaspartylprolylleucyl-
alanylaspartylglycylprolylthreonylisoleucylglutaminylasparaginyl-
alanylthreonylleucylarginylalanylphenylalanylalanylalanyl-
glycylvalylthreonylprolylalanylglutaminylcysteinylphenylalanyl-
glutamylmethionylleucylalanylleucylisoleucylarginylglutaminyl-
lysylhistidylprolylthreonylisoleucylprolylisoleucylglycylleucyl-
leucylmethionyltyrosylalanylasparaginylleucylvalylphenylalanyl-
asparaginyllysylglycylisoleucylaspartylglutamylphenylalanyl-
tyrosylalanylglutaminylcysteinylglutamyllysylvalylglycylvalyl-
aspartylsrylvalylleucylvalylalanylaspartylvalylprolylvalyl-
glutaminylglutamylserylalanylprolylphenylalanylarginylglutaminyl-
alanylalanylleucylarginylhistidylasparaginylvalylalanyl-
prolylisoleucylphenylalanylisoleucylcysteinylprolylprolylaspartyl-
alanylaspartylaspartylaspartylleucylleucylarginylglutaminyl-
isoleucylalanylseryltyrosylglycylarginylglycyltyrosylthreonyl-
tyrosylleucylleucylserylarginylalanylglycylvalylthreonylglycyl-
alanylglutamylasparaginylarginylalanylalanylleucylleucyllysyl-
glutamyltyrosylasparaginylalanylalanylprolylprolylleucylglutaminyl-
glycylphenylalanylglysylisoleucylserylalanylprolylaspartylglutaminyl-
valyllysylalanylalanylisoleucylaspartylalanylglycylalanylalanyl-
glycylalanylisoleucylserylglycylserylalanylisoleucylvalyllysylisoleucyl-
isoleucylglutamylglutaminylhistidylasparaginylisoleucylglutamyl-
prolylglutamyllysylmethionylleucylalanylalanylleucyllysylvalylphenyl-
alanylvalylglutaminylprolylmethionyllysylalanylalanylthreonylarginy-
lserine.
The longest official word ever (1,913 letters) is the term for the formula C1289H2051N343O375S8.
I won the 3rd grade spelling bee with that! (not)



 
Printer Friendly | Permalink |  | Top
 
Aristus Donating Member (1000+ posts) Send PM | Profile | Ignore Wed Aug-13-03 07:42 PM
Response to Original message
19. Honorificibilitudinitatibus.
It's the longest word in any of Shakespeare's plays.
Printer Friendly | Permalink |  | Top
 
Quizzical Donating Member (44 posts) Send PM | Profile | Ignore Wed Aug-13-03 07:42 PM
Response to Original message
20. Hippopotomontrosesquipedalianism
This is a term for "the practice of using long words."
Printer Friendly | Permalink |  | Top
 
dweller Donating Member (1000+ posts) Send PM | Profile | Ignore Wed Aug-13-03 08:01 PM
Response to Original message
21. and all this time i thought it was a
*term.

seems it lasts forfuckinevvvvvver.
and is as floccinaucinihilipilificated as anything i've ever known.

dp
Printer Friendly | Permalink |  | Top
 
Yentatelaventa Donating Member (292 posts) Send PM | Profile | Ignore Wed Aug-13-03 08:31 PM
Response to Original message
22. Life
Length unknown until it expires.
Printer Friendly | Permalink |  | Top
 
NashVegas Donating Member (1000+ posts) Send PM | Profile | Ignore Wed Aug-13-03 08:35 PM
Response to Original message
23. If I can spell it right - triskaidecaphobia
Okay, so I can't spell it right.

It's fear of Friday the 13th.
Printer Friendly | Permalink |  | Top
 
nothingshocksmeanymore Donating Member (1000+ posts) Send PM | Profile | Ignore Wed Aug-13-03 09:17 PM
Response to Original message
24. Wait
whther it's a minute or an hour it's the longest word I know
Printer Friendly | Permalink |  | Top
 
leftofthedial Donating Member (1000+ posts) Send PM | Profile | Ignore Wed Aug-13-03 09:35 PM
Response to Original message
25. B-u-s-h
two and a half years seems like an eternity.
Printer Friendly | Permalink |  | Top
 
orangecoloredapple Donating Member (290 posts) Send PM | Profile | Ignore Wed Aug-13-03 09:38 PM
Response to Original message
26. I only listen to the news - I am hypnotized
so-
the longest word I've heard is................

subliminal.......

liar..........
Printer Friendly | Permalink |  | Top
 
Paragon Donating Member (1000+ posts) Send PM | Profile | Ignore Wed Aug-13-03 09:43 PM
Response to Original message
27. p-o-t-a-t-o-e
Printer Friendly | Permalink |  | Top
 
sexybomber Donating Member (1000+ posts) Send PM | Profile | Ignore Thu Aug-14-03 08:38 AM
Response to Original message
30. humuhumunukunukuapua'a
the Hawaiian state fish.
Printer Friendly | Permalink |  | Top
 
Aristus Donating Member (1000+ posts) Send PM | Profile | Ignore Thu Aug-14-03 08:47 AM
Response to Reply #30
31. How about the famous Hawaiian pick-up line?
Kamanawanaleia!
Printer Friendly | Permalink |  | Top
 
sexybomber Donating Member (1000+ posts) Send PM | Profile | Ignore Thu Aug-14-03 08:48 AM
Response to Reply #31
32. never heard that one
what's it mean?
Printer Friendly | Permalink |  | Top
 
Superfly Donating Member (1000+ posts) Send PM | Profile | Ignore Thu Aug-14-03 09:06 AM
Response to Original message
34. Donaudampfschiffahrtsgesellschaftskapitaens....
kajuetenklinenputzergehilfe


Sorry, couldn't fit it all in the subject line.

Printer Friendly | Permalink |  | Top
 
LincolnMcGrath Donating Member (1000+ posts) Send PM | Profile | Ignore Thu Aug-14-03 09:34 AM
Response to Original message
35. (92 characters)
Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu

http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/






And finally, sadly even the 67 character allowance for a .com domain name is still insufficient for the town of Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu
in New Zealand with a staggering 92 characters however even this seems positively tiny compared to the town of

Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop
nopparatrajathaniburiromudomrajaniwesmahasatharn
amornphimarnavatarnsathitsakkattiyavisanukamprasit

in Thailand which is a whopping 163 characters long so long that it doesn't even fit on one line! However whilst the New Zealand place name is recognised by the Guiness Book of Record, the Thailand name is not.

Other long names (but not place names) include words such as Pneumonoultramicroscopicsilicovolcanokoniosis (and many others) .

Printer Friendly | Permalink |  | Top
 
cmd Donating Member (1000+ posts) Send PM | Profile | Ignore Thu Aug-14-03 10:25 AM
Response to Original message
37. Smiles - there's a mile between the s's
I know - first grade joke. I have dozens of them in my portfolio. I'll just leave the rest of them in there.
Printer Friendly | Permalink |  | Top
 
MaineDem Donating Member (1000+ posts) Send PM | Profile | Ignore Thu Aug-14-03 10:52 AM
Response to Reply #37
40. Great minds
I was thinking the same thing. :D
Printer Friendly | Permalink |  | Top
 
Malikshah Donating Member (1000+ posts) Send PM | Profile | Ignore Thu Aug-14-03 10:48 AM
Response to Original message
38. Anti-interdigitationist
No--it's not the longest--but it just stuck w/ me from 6th grade when our teacher taught us it re: breaking words down...

Hey Mr. Lanciani!
Printer Friendly | Permalink |  | Top
 
rabid_nerd Donating Member (1000+ posts) Send PM | Profile | Ignore Thu Aug-14-03 10:50 AM
Response to Original message
39. Longest one I use is sphygmomanometer...
I learned to spell it at 3.

It's the blood-pressure thingies..
Printer Friendly | Permalink |  | Top
 
XNASA Donating Member (1000+ posts) Send PM | Profile | Ignore Thu Aug-14-03 10:58 AM
Response to Original message
41. Antidisestablishmentarianism
def - the belief that the separation between church and state should be removed.

sent - Those freepers are all about antidisestablishmentarianism.

Printer Friendly | Permalink |  | Top
 
Bossy Monkey Donating Member (1000+ posts) Send PM | Profile | Ignore Thu Aug-14-03 11:32 AM
Response to Reply #41
45. Isn't it odd that this is listed as one of the longest words...
when antidisestablismentarianistic is obviously longer?
Printer Friendly | Permalink |  | Top
 
protect freedom impeach bush now Donating Member (1000+ posts) Send PM | Profile | Ignore Thu Aug-14-03 11:11 AM
Response to Original message
42. place name in N Wales. 58 letters
this is the 2nd longest in the world

Llanfairpwllgwyngyllgogerychwypndroewalliantysiliogogogoch

WALES boasts a village called Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch (58 letters), which in English means "Saint Mary's Church in the hollow of white hazel near a rapid whirlpool and the Church of Saint Tysilio near the red cave." The locals call it Llanfairpwll (pronounced thlan vire puth). We'll call it L56h.

http://www.thailandlife.com/ericshackle/placename.html

(A little secret: as many double letters in English are regarded as single letters in Welsh, the name has only 51 letters)."

Internet sites normally have a maximum of 28 letters but the rules were bent for L56h. Its website says the village was known until the 19th century as Llanfair Pwllgwyngyll - St Mary's church near the pool by the white hazels. To encourage train travellers to stop off, a cobbler suggested stretching the name. Local author John Williams believes that a tailor coined the tongue-twisting name to confuse the English. The website is at:

http://llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.co.uk/

NEW ZEALAND stakes its claim on the Maori name for a hill near Porangahau, Hawkes Bay, which is spelt with either 85 or 92 letters. Visitors climb the hill in four-wheel-drive vehicles. The Duke of Edinburgh Hotel invites them to buy a "Collectors' Longest Place Name Bottle of Hawkes Bay Chardonnay or Cab Merlot."

The hill used to be called Taumatawhakatangihangakoauauotamateaturipukaka pikimaunga horonukupokaiwhenuakitanatahu (85 letters). That's a combination of the words taumata (brow of a hill), whakatangihanga (music making), koauau (flute), o (of), tamatea (name of a famous chief), turi pukaka (bony knees), piki maunga (climbing a mountain), horo (slip), nuku (move), pokai whenua (widely travelled), ki (to), tana (his), tahu (beloved).

Hawkes Bay Tourism's Internet site says that Porangahau in New Zealand's South Island, "boasts the longest place name in the world:

Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronuku pokaiwhenuaakitanarahu, officially entered in the Guinness Book of Records." That stretches the name to 92 letters.

Printer Friendly | Permalink |  | Top
 
playahata1 Donating Member (1000+ posts) Send PM | Profile | Ignore Thu Aug-14-03 11:13 AM
Response to Original message
43. southernplayalisticcadillacmusik
That's from OUTKAST, for all you hip-hop heads.
Printer Friendly | Permalink |  | Top
 
MaineDem Donating Member (1000+ posts) Send PM | Profile | Ignore Thu Aug-14-03 11:16 AM
Response to Original message
44.  Lake Chargoggagoggmanchauggauggagoggchaubunagungamaugg
AKA Webster Lake in Central Massachusetts.

Don't even ask me to pronounce it. I was told once it means "You fish on your side and I'll fish on my side"
Printer Friendly | Permalink |  | Top
 
DU AdBot (1000+ posts) Click to send private message to this author Click to view 
this author's profile Click to add 
this author to your buddy list Click to add 
this author to your Ignore list Mon May 13th 2024, 10:30 AM
Response to Original message
Advertisements [?]
 Top

Home » Discuss » The DU Lounge Donate to DU

Powered by DCForum+ Version 1.1 Copyright 1997-2002 DCScripts.com
Software has been extensively modified by the DU administrators


Important Notices: By participating on this discussion board, visitors agree to abide by the rules outlined on our Rules page. Messages posted on the Democratic Underground Discussion Forums are the opinions of the individuals who post them, and do not necessarily represent the opinions of Democratic Underground, LLC.

Home  |  Discussion Forums  |  Journals |  Store  |  Donate

About DU  |  Contact Us  |  Privacy Policy

Got a message for Democratic Underground? Click here to send us a message.

© 2001 - 2011 Democratic Underground, LLC